PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.7G212600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family HRT-like
Protein Properties Length: 448aa    MW: 49504.4 Da    PI: 9.677
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.7G212600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like58.31.3e-18269299131
            HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                         iCGv  +dGs+C+++Pv+gRKRC++HKGmRi
  Prupe.7G212600.1.p 269 ICGVDVGDGSICRMPPVPGRKRCAKHKGMRI 299
                         8*****************************7 PP

2HRT-like61.61.2e-19343373131
            HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                         iCG+il dGsvC+++Pv+gRKRC++HKGmRi
  Prupe.7G212600.1.p 343 ICGFILADGSVCRTPPVPGRKRCAKHKGMRI 373
                         8*****************************7 PP

3HRT-like57.22.8e-18417447131
            HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                         iCG+il dGs C+r+P++gRKRC eHKG+Ri
  Prupe.7G212600.1.p 417 ICGFILADGSSCRRHPIQGRKRCDEHKGKRI 447
                         8*****************************7 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000033Biological Processregulation of seed dormancy process
GO:0097100Molecular Functionsupercoiled DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 448 aa     Download sequence    Send to blast
MGASDLTVAV TRLKREDCKR TKHDSHFSNW KILVGPSDWE DYSLGIEGAE RYRVHNLPEK  60
ESPGVYELGI AFLRTGLGRE IGKLDPDYIV PVYLGQADNV RTRLQQYGRS GAHLGNGCPT  120
GHPSDRVQKG PGLFAEILSR DYPVVYRWAP MENKSVALKT ETQLLNTFDY AWNTNINGAR  180
RPDDVLKKLK MVSSSPTRFV NIAQKLVPFS PKKVGTRIES SILLSPEDKF SAYANRESHN  240
PLSRVFKLGR SQPRLVLDRI GITQENTIIC GVDVGDGSIC RMPPVPGRKR CAKHKGMRIN  300
MSTRVGISNS TVDSESECSA ISSIEFHGAQ IINSDPVESF TSICGFILAD GSVCRTPPVP  360
GRKRCAKHKG MRINRSTRVG ISNSTVDSES ECSAISSGVF HDAQIINRYP VESFTSICGF  420
ILADGSSCRR HPIQGRKRCD EHKGKRI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007203167.10.0hypothetical protein PRUPE_ppa025028mg, partial
TrEMBLM5VTH70.0M5VTH7_PRUPE; Uncharacterized protein (Fragment)
STRINGVIT_11s0016g02440.t011e-135(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF94093139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56780.15e-96effector of transcription2